PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625486.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 542aa    MW: 60652.7 Da    PI: 4.4851
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625486.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.61e-52101371128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yL++k+ gk+l++ ++i+e+diykvePwdLp  +++k+++ ewyfFs  dkk+ +g ++nrat++gyWk+tgkd++v+
  XP_009625486.1  10 LAPGFRFHPTDEELVRYYLRRKIIGKPLRF-DAISEIDIYKVEPWDLPgmSRLKTRDLEWYFFSMLDKKHGNGAKTNRATERGYWKTTGKDRAVH 103
                     579*************************99.99***************6347788888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + k+++vg+kktLv+++grapkg++t+Wvmhey+l
  XP_009625486.1 104 H-KSKVVGMKKTLVYHSGRAPKGQRTNWVMHEYKL 137
                     *.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-617160IPR003441NAC domain
PROSITE profilePS5100558.1810160IPR003441NAC domain
PfamPF023657.5E-2812137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
METRRSKNLL APGFRFHPTD EELVRYYLRR KIIGKPLRFD AISEIDIYKV EPWDLPGMSR  60
LKTRDLEWYF FSMLDKKHGN GAKTNRATER GYWKTTGKDR AVHHKSKVVG MKKTLVYHSG  120
RAPKGQRTNW VMHEYKLIDE ELDKAGIAQD AFVLCRIFQK SGAGPKNGEK YGAPFVEEEW  180
EDDELEIVPK EEAADEVEFG DDIYLDGHDL EQILGTDTPV DGAPPPFNRY CEENASNSGG  240
TSYSFEDTEK WLQPPDEQES FDPAIEENAS ANPVKHEFMS EPSKNVNSED VDYLFNEPIE  300
TATDTLQFND GAFLEASDLS RPIDTSSFDM LEEYLTFFDA DDDFQNMGFN PPMMIGGDDH  360
VSDLASLADK NIGEVADQPI APSEEPTDQK TNVASSSKLE PSKFGSDYKY PFMKQASCML  420
GGIPAPPAFA SEFPSKDAAF RMNSSSEASS SIHVTAGYIQ IRNITMSGNG TDGLVGKHGN  480
YNILLSFGLS QHADSSASLE SVISILPGKT ISTASWCWFY YLLSWILILS MSFKIGTLIR  540
AI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-451016620174NAC domain-containing protein 19
3swm_B7e-451016620174NAC domain-containing protein 19
3swm_C7e-451016620174NAC domain-containing protein 19
3swm_D7e-451016620174NAC domain-containing protein 19
3swp_A7e-451016620174NAC domain-containing protein 19
3swp_B7e-451016620174NAC domain-containing protein 19
3swp_C7e-451016620174NAC domain-containing protein 19
3swp_D7e-451016620174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625486.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLM1C5720.0M1C572_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000600900.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.11e-134NAC domain containing protein 53